Structure of PDB 4a4j Chain A |
>4a4jA (length=69) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] |
AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHGET TPQILTDAVERAGYHARVL |
|
PDB | 4a4j Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803. |
Chain | A |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
7.2.2.8: P-type Cu(+) transporter. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D13 C14 C17 |
D12 C13 C16 |
|
|
|
|