Structure of PDB 4a2o Chain A

Receptor sequence

>4a2oA (length=133) Species: 9606 (Homo sapiens)

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFAN
VVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYAD
RPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

3D structure

• PDB: 4a2o The Sulfate-Binding Site Structure of the Human Eosinophil Cationic Protein as Revealed by a New Crystal Form.
• Chain: A
• Resolution: 1.69 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K38 H128 L129 D130
• Catalytic site (residue number reindexed from 1): K38 H128 L129 D130
• Enzyme Commision number: 3.1.27.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	A	R34 R36 K38 N39	R34 R36 K38 N39
BS02	SO4	A	R1 R7	R1 R7
BS03	SO4	A	R77 R104	R77 R104
BS04	SO4	A	R61 R66	R61 R66

Gene Ontology

Molecular Function

• GO:0001530 lipopolysaccharide binding
• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0006401 RNA catabolic process
• GO:0006935 chemotaxis
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0043152 induction of bacterial agglutination
• GO:0045087 innate immune response
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0035578 azurophil granule lumen

External links

• PDB: RCSB:4a2o, PDBe:4a2o, PDBj:4a2o
• PDBsum: 4a2o
• PubMed: 22579681
• UniProt: P12724|ECP_HUMAN Eosinophil cationic protein (Gene Name=RNASE3)