Structure of PDB 451c Chain A

Receptor sequence
>451cA (length=82) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKN
GSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
3D structure
PDB451c Structure of cytochrome c551 from Pseudomonas aeruginosa refined at 1.6 A resolution and comparison of the two redox forms.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A C12 C15 H16 G24 P25 Y27 L44 R47 I48 S52 Q53 G54 V55 W56 G57 P60 M61 N64 C12 C15 H16 G24 P25 Y27 L44 R47 I48 S52 Q53 G54 V55 W56 G57 P60 M61 N64
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:451c, PDBe:451c, PDBj:451c
PDBsum451c
PubMed6283101
UniProtP00099|CY551_PSEAE Cytochrome c-551 (Gene Name=nirM)

[Back to BioLiP]