Structure of PDB 3zzr Chain A |
>3zzrA (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
ECCTSRELVEFKMDRGDCEAVRAIENYPNGCEVTICADGVAQLGAYCGQG PCNIFGCNCDGGCLSGDWSQEFVRRNQQYGIQIIKVTRLPFWRPL |
|
PDB | 3zzr Crystal Structure of Diedel, a Marker of the Immune Response of Drosophila Melanogaster. |
Chain | A |
Resolution | 1.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D91 Q94 |
D67 Q70 |
|
|
|
|