Structure of PDB 3zz6 Chain A

Receptor sequence

>3zz6A (length=181) Species: 12072 (Coxsackievirus B3)

MGPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILM
NDQEVGVLDAKELVDKDGTNLELTLLKLNRNEKFRDIRGFLAKEEVEVNE
AVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGG
VLMSTGKVLGIHVGGNGHQGFSAALLKHYFN

3D structure

• PDB: 3zz6 Peptidic Ab-Nonsaturated Ethyl Esters as Inhibitors of the 3C Protease of Coxsackie Virus B3: Crystal Structures, Antiviral Activities, and Resistance Mutations
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H40 E71 G145 C147
• Catalytic site (residue number reindexed from 1): H41 E72 G146 C148
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.22.28: picornain 3C.
  3.4.22.29: picornain 2A.
  3.6.1.15: nucleoside-triphosphate phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	G75	A	E24 F25 H40 E71 N126 L127 G128 T142 R143 A144 G145 C147 H161 V162 G163 G164 N165	E25 F26 H41 E72 N127 L128 G129 T143 R144 A145 G146 C148 H162 V163 G164 G165 N166

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3zz6, PDBe:3zz6, PDBj:3zz6
• PDBsum: 3zz6
• UniProt: Q5UEA2