Structure of PDB 3zs8 Chain A

Receptor sequence
>3zs8A (length=280) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLL
ISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDGIDEALS
FMEVMKHIKRQEQETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEIT
NKLKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDV
NSIIVNQLLFAENCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEI
RGLNNLTKFSQFLNKEYNPITDGKVIYELE
3D structure
PDB3zs8 The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
ChainA
Resolution3.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G28 G30 K31 T32 T33 D57
Catalytic site (residue number reindexed from 1) G25 G27 K28 T29 T30 D54
Enzyme Commision number 3.6.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C285 C288 C214 C217
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0044183 protein folding chaperone
GO:0046872 metal ion binding
GO:0051082 unfolded protein binding
Biological Process
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0006457 protein folding
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0009408 response to heat
GO:0010038 response to metal ion
GO:0016192 vesicle-mediated transport
GO:0034599 cellular response to oxidative stress
GO:0045048 protein insertion into ER membrane
GO:0046685 response to arsenic-containing substance
GO:0071816 tail-anchored membrane protein insertion into ER membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0043529 GET complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3zs8, PDBe:3zs8, PDBj:3zs8
PDBsum3zs8
PubMed21866104
UniProtQ12154|GET3_YEAST ATPase GET3 (Gene Name=GET3)

[Back to BioLiP]