Structure of PDB 3zkc Chain A

Receptor sequence
>3zkcA (length=61) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVS
AVLDVSVHTLL
3D structure
PDB3zkc Molecular Basis of the Activity of Sinr, the Master Regulator of Biofilm Formation in Bacillus Subtilis.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A A27 S29 Y30 Q39 N41 P42 S43 A26 S28 Y29 Q38 N40 P41 S42 PDBbind-CN: Kd=360nM
BS02 dna A S16 L17 S18 K28 S29 S32 R36 S15 L16 S17 K27 S28 S31 R35 PDBbind-CN: Kd=360nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010629 negative regulation of gene expression
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zkc, PDBe:3zkc, PDBj:3zkc
PDBsum3zkc
PubMed23430750
UniProtP06533|SINR_BACSU HTH-type transcriptional regulator SinR (Gene Name=sinR)

[Back to BioLiP]