Structure of PDB 3zk1 Chain A

Receptor sequence

>3zk1A (length=89) Species: 851 (Fusobacterium nucleatum)

MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEAR
GSIISTMILGQAVAESTGIYSLVIALILLYANPFLSKLG

3D structure

• PDB: 3zk1 A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DMU	A	M1 I9 C13	M1 I9 C13

Gene Ontology

Molecular Function

• GO:0008289 lipid binding
• GO:0015078 proton transmembrane transporter activity
• GO:0042802 identical protein binding
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:3zk1, PDBe:3zk1, PDBj:3zk1
• PDBsum: 3zk1
• PubMed: 23824040
• UniProt: Q8RGD7|ATPL_FUSNN ATP synthase subunit c (Gene Name=atpE)