Structure of PDB 3x44 Chain A

Receptor sequence

>3x44A (length=321) Species: 1914 (Streptomyces lavendulae)

PLFNSILDTIGRTPIVRLQRMAPEHTSVYVKVESFNPGGSVADRLALSVV
LDAEAKGLLKPGDTIVECTSGNVGIALAMVAAARGYRFVAVMGDTYSVER
RKLIRAYGGKLVLFPGHLGSKGGNLIADELAEKYGWFRARQFDNPANPSY
HRETTASEILADFAGKRLDHFVTGFGTTGTLTGVGQMLRVARPEVRVVAL
EPSNAAMLARGEWSPHQIQGLAPNFVPGVLDRSVIDDLVTMDEVTARDTS
RRLAAEEGIFAGISAGATVATALSIAEHAPEGTVLLAMLPDTGERYLSTF
LFDGVDEGSDDAWLASLDTGS

3D structure

• PDB: 3x44 The structural and mutational analyses of O-ureido-L-serine synthase necessary for D-cycloserine biosynthesis.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A43 S265
• Catalytic site (residue number reindexed from 1): A42 S264
• Enzyme Commision number: 2.5.1.47: cysteine synthase.
  2.6.99.3: O-ureido-L-serine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PUS	A	T70 S71 N73 V74 S121 Q142 F176 G177 T178 T179 T181 G221 L222 P224 S265 P291 D292	T69 S70 N72 V73 S120 Q141 F175 G176 T177 T178 T180 G220 L221 P223 S264 P290 D291

Gene Ontology

Molecular Function

• GO:0004124 cysteine synthase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0080146 L-cysteine desulfhydrase activity

Biological Process

• GO:0006535 cysteine biosynthetic process from serine
• GO:0017000 antibiotic biosynthetic process
• GO:0019344 cysteine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3x44, PDBe:3x44, PDBj:3x44
• PDBsum: 3x44
• PubMed: 26207937
• UniProt: D2Z027|DCSD_STRLA O-ureido-L-serine synthase (Gene Name=dcsD)