Structure of PDB 3x0b Chain A

Receptor sequence
>3x0bA (length=318) Species: 9606 (Homo sapiens) [Search protein sequence]
KVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVDN
HLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINTRF
LTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRL
TVDGVETYMVVTRNVFSHRLTVHRKYDLKGVAREASDKEKAKDLPTFKDN
DFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRA
EQEEMEVEERAEDGPGEFDPSVDVYAMKSHESSPKKEVYFMAIADILTTV
NPEQYSKRFNEFMSNILT
3D structure
PDB3x0b The Lipid Kinase PI5P4K beta Is an Intracellular GTP Sensor for Metabolism and Tumorigenesis
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K150 D278
Catalytic site (residue number reindexed from 1) K111 D237
Enzyme Commision number 2.7.1.149: 1-phosphatidylinositol-5-phosphate 4-kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMP A F139 N203 V204 K214 D369 F100 N164 V165 K175 D295
BS02 AMP A Q293 E297 Q252 E256
BS03 AMP A K96 Y98 S154 A158 H161 Y197 K65 Y67 S115 A119 H122 Y158
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0016301 kinase activity
GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0016309 1-phosphatidylinositol-5-phosphate 4-kinase activity
GO:0042803 protein homodimerization activity
GO:0052742 phosphatidylinositol kinase activity
Biological Process
GO:0006629 lipid metabolic process
GO:0007166 cell surface receptor signaling pathway
GO:0010506 regulation of autophagy
GO:0016310 phosphorylation
GO:0046488 phosphatidylinositol metabolic process
GO:0046627 negative regulation of insulin receptor signaling pathway
GO:0046854 phosphatidylinositol phosphate biosynthetic process
GO:0061909 autophagosome-lysosome fusion
GO:1902635 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process
GO:2000786 positive regulation of autophagosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x0b, PDBe:3x0b, PDBj:3x0b
PDBsum3x0b
PubMed26774281
UniProtP78356|PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta (Gene Name=PIP4K2B)

[Back to BioLiP]