Structure of PDB 3wzv Chain A

Receptor sequence

>3wzvA (length=364) Species: 211586 (Shewanella oneidensis MR-1)

SSYQIAVLAGDGIGPEVMAEARKVLKAVEARFGLNIEYTEYDVGGIAIDN
HGCPLPEATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHF
ELFCNLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGR
QGEGESEEAFDTMRYSRREISRIARIAFEAARGRRKKVTSVDKANVLACS
VLWRQVVEEVAVDFPDVELEHIYIDNATMQLLRRPDEFDVMLCSNLFGDI
LSDEIAMLTGSMGLLSSASMNSTGFGLFEPAGGSAPDIAGKGIANPIAQI
LSAALMLRHSLKQEEAASAIERAVTKALNSGYLTGELLSSDQRHKAKTTV
QMGDFIADAVKAGV

3D structure

• PDB: 3wzv Pressure Adaptation of 3-Isopropylmalate Dehydrogenase from the Extremely Piezophilic Bacterium Shewanella benthica is Attributed to just One Amino Acid Substitution
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y143 K193 D225 D249 D253
• Catalytic site (residue number reindexed from 1): Y143 K193 D225 D249 D253
• Enzyme Commision number: 1.1.1.85: 3-isopropylmalate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IPM	A	E89 R97 R107 R136 Y143 D249	E89 R97 R107 R136 Y143 D249

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003862 3-isopropylmalate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding
• GO:0051287 NAD binding

Biological Process

• GO:0009098 L-leucine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3wzv, PDBe:3wzv, PDBj:3wzv
• PDBsum: 3wzv
• UniProt: Q8E9N3|LEU3_SHEON 3-isopropylmalate dehydrogenase (Gene Name=leuB)