Structure of PDB 3wtp Chain A

Receptor sequence

>3wtpA (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]

GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQ
EAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG

3D structure

PDB

3wtp Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3

Chain

Resolution

2.67 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R72 N85 W86 Q87 A88 R118 V119 T120 F122	R27 N40 W41 Q42 A43 R73 V74 T75 F77
BS02	dna	A	G46 K49 K56 R63 K64 L65 R69	G1 K4 K11 R18 K19 L20 R24

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0000281	mitotic cytokinesis
GO:0034080	CENP-A containing chromatin assembly
GO:0051301	cell division
GO:0051382	kinetochore assembly
GO:0061644	protein localization to CENP-A containing chromatin
GO:0071459	protein localization to chromosome, centromeric region

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000779	condensed chromosome, centromeric region
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005721	pericentric heterochromatin
GO:0005829	cytosol
GO:0043505	CENP-A containing nucleosome
GO:0061638	CENP-A containing chromatin

External links

PDB	RCSB:3wtp, PDBe:3wtp, PDBj:3wtp
PDBsum	3wtp
PubMed	25408271
UniProt	P49450\|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)