Structure of PDB 3wh6 Chain A

Receptor sequence

>3wh6A (length=443) Species: 408169 (metagenomes)

MAGERFPADFVWGAATAAYQIEGAVREDGRGVSIWDTFSHTPGKIADGTT
GDVACDSYHRYGEDIGLLNALGMNAYRFSIAWPRIVPLGAGPINQAGLDH
YSRMVDALLGAGLQPFVTLYHWDLPQPLEDRLGWGSRATATVFAEYADIV
VRQLGDRVTHWATLNEPWCSAMLGYYLGVHAPGHTDLKRGLEASHNLLLG
HGLAVQAMRAAAPQPLQIGIVLNLTPTYPASDSPEDVAAARRFDGFVNRW
FLDPLAGRGYPQDMLDYYGAAAPQANPEDLTQIAAPLDWLGVNYYERMRA
VDAPDASLPQAQRLDDPDLPHTADREVYPEGLYDILLRLHNDYPFRPLYI
TENGCALHDEIAEDGGIHDGQRQAFFEAHLAQLQRALAAGVPLKGYFAWS
LLDNFEWAMGLSMRYGICYTNFETLERRIKDSGYWLRDFIAGQ

3D structure

• PDB: 3wh6 Crystal structure and identification of a key amino acid for glucose tolerance, substrate specificity, and transglycosylation activity of metagenomic beta-glucosidase Td2F2.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	A	Q20 H121 E166 Y295 R325 E352 W399 E406 W407 Y415	Q20 H121 E166 Y295 R325 E352 W399 E406 W407 Y415
BS02	BGC	A	H40 P42 G48	H40 P42 G48
BS03	BGC	A	D28 Y58 H59 H100 R103	D28 Y58 H59 H100 R103
BS04	GLC	A	H358 S412 R414	H358 S412 R414

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Feb 22 11:33:05 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3wh6', asym_id = 'A', title = 'Crystal structure and identification of a key am... activity of metagenomic beta-glucosidase Td2F2. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3wh6', asym_id='A', title='Crystal structure and identification of a key am... activity of metagenomic beta-glucosidase Td2F2. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004553,0005975,0008422,0030245', uniprot = '', pdbid = '3wh6', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004553,0005975,0008422,0030245', uniprot='', pdbid='3wh6', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>