Structure of PDB 3w4u Chain A

Receptor sequence
>3w4uA (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHP
GSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKL
LSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
3D structure
PDB3w4u Structure of fully liganded Hb zeta 2 beta 2(s) trapped in a tense conformation
ChainA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A Y42 F43 F46 H58 A65 L83 H87 L91 V93 N97 F98 L101 L136 Y42 F43 F46 H58 A65 L83 H87 L91 V93 N97 F98 L101 L136
BS02 CMO A H58 V62 H58 V62
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3w4u, PDBe:3w4u, PDBj:3w4u
PDBsum3w4u
PubMed24100324
UniProtP02008|HBAZ_HUMAN Hemoglobin subunit zeta (Gene Name=HBZ)

[Back to BioLiP]