Structure of PDB 3w2i Chain A

Receptor sequence

>3w2iA (length=271) Species: 9823 (Sus scrofa)

TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIY
LSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQY
LESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHS
ARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMI
QYACLPNLERVGHPKERCFAF

3D structure

• PDB: 3w2i Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
• Chain: A
• Resolution: 1.81 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H49 Y65 T66 C245
• Catalytic site (residue number reindexed from 1): H48 Y64 T65 C244
• Enzyme Commision number: 1.6.2.2: cytochrome-b5 reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	R63 P64 Y65 T66 V80 I81 Y84 H89 F92 G95 G96 K97 M98 S99 T153 T156	R62 P63 Y64 T65 V79 I80 Y83 H88 F91 G94 G95 K96 M97 S98 T152 T155
BS02	NAD	A	K82 Y84 G152 T153 N181 Q182 D211 F223 C245 G246 P247 P249 M250	K81 Y83 G151 T152 N180 Q181 D210 F222 C244 G245 P246 P248 M249

Gene Ontology

Molecular Function

• GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0006695 cholesterol biosynthetic process

Cellular Component

• GO:0005575 cellular_component
• GO:0005739 mitochondrion
• GO:0005741 mitochondrial outer membrane
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane

External links

• PDB: RCSB:3w2i, PDBe:3w2i, PDBj:3w2i
• PDBsum: 3w2i
• PubMed: 23831226
• UniProt: P83686|NB5R3_PIG NADH-cytochrome b5 reductase 3 (Fragment) (Gene Name=CYB5R3)