Structure of PDB 3vym Chain A |
>3vymA (length=80) Species: 608538 (Hydrogenobacter thermophilus TK-6) [Search protein sequence] |
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGG SGVWGSVPMPPQNVTDAEAKQLAQWILSIK |
|
PDB | 3vym Domain Swapping of the Heme and N-Terminal alpha-Helix in Hydrogenobacter thermophilus Cytochrome c(552) Dimer |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEC |
A |
C10 C13 H14 |
C10 C13 H14 |
|
|
|
|