Structure of PDB 3vy6 Chain A

Receptor sequence
>3vy6A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence]
RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKV
WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG
KDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDV
3D structure
PDB3vy6 Structural Basis for Multiple Sugar Recognition of Jacalin-related Human ZG16p Lectin
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BGC A G35 Y104 G147 S148 L149 D151 G14 Y83 G126 S127 L128 D130
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030246 carbohydrate binding
GO:0042834 peptidoglycan binding
Biological Process
GO:0015031 protein transport
GO:0050830 defense response to Gram-positive bacterium
GO:0052373 suppression of symbiont entry into host
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005794 Golgi apparatus
GO:0005796 Golgi lumen
GO:0031410 cytoplasmic vesicle
GO:0042589 zymogen granule membrane
GO:0062023 collagen-containing extracellular matrix
GO:0070701 mucus layer

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vy6, PDBe:3vy6, PDBj:3vy6
PDBsum3vy6
PubMed24790092
UniProtO60844|ZG16_HUMAN Zymogen granule membrane protein 16 (Gene Name=ZG16)

[Back to BioLiP]