Structure of PDB 3vxw Chain A

Receptor sequence
>3vxwA (length=111) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLV
PADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDK
DGFLYVTYSGE
3D structure
PDB3vxw Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E17 R28 P30 K48 Y49 L50 P52 F104 E16 R27 P29 K47 Y48 L49 P51 F103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
GO:0031386 protein tag activity
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0016241 regulation of macroautophagy
GO:0031503 protein-containing complex localization
GO:0032258 cytoplasm to vacuole targeting by the Cvt pathway
GO:0034497 protein localization to phagophore assembly site
GO:0034727 piecemeal microautophagy of the nucleus
GO:0044804 nucleophagy
GO:0061025 membrane fusion
GO:0061709 reticulophagy
GO:0071211 protein targeting to vacuole involved in autophagy
GO:0097352 autophagosome maturation
GO:0140042 lipid droplet formation
GO:1905153 regulation of membrane invagination
Cellular Component
GO:0000329 fungal-type vacuole membrane
GO:0000407 phagophore assembly site
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005773 vacuole
GO:0005776 autophagosome
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0033110 Cvt vesicle membrane
GO:0120095 vacuole-isolation membrane contact site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vxw, PDBe:3vxw, PDBj:3vxw
PDBsum3vxw
PubMed22308029
UniProtP38182|ATG8_YEAST Autophagy-related protein 8 (Gene Name=ATG8)

[Back to BioLiP]