Structure of PDB 3vw4 Chain A

Receptor sequence

>3vw4A (length=122) Species: 562 (Escherichia coli) [Search protein sequence]

HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVP
LSPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSA
RSLKPWEALGISRATYYRKLKC

3D structure

PDB

3vw4 Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	K185 R189 R252 G253 K255 G256 K259 S260 R262 I280 S281 T284 R287	K16 R20 R83 G84 K86 G87 K90 S91 R93 I111 S112 T115 R118
BS02	dna	A	N176 F180 R184 Y188 R189 R192 S231 Y235 K239 F240 S241 G244 F245 S246 V248 Q249 A250 R252 G253 R254 G257 T258 S260 K261 R262 A263 A264 V265 S268 A269 R270 R282 Y286 R287	N7 F11 R15 Y19 R20 R23 S62 Y66 K70 F71 S72 G75 F76 S77 V79 Q80 A81 R83 G84 R85 G88 T89 S91 K92 R93 A94 A95 V96 S99 A100 R101 R113 Y117 R118
BS03	dna	A	H174 Y177	H5 Y8

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

External links