Structure of PDB 3vq6 Chain A

Receptor sequence

>3vq6A (length=145) Species: 11676 (Human immunodeficiency virus 1)

SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLA
GRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPVIESMNKELKKII
GQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD

3D structure

• PDB: 3vq6 Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCK	A	G140 P142	G85 P87

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:3vq6, PDBe:3vq6, PDBj:3vq6
• PDBsum: 3vq6
• PubMed: 23139382
• UniProt: Q72498