Structure of PDB 3veb Chain A

Receptor sequence
>3vebA (length=146) Species: 632 (Yersinia pestis) [Search protein sequence]
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEP
VKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVW
QRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
3D structure
PDB3veb Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y30 K33 K34 R82 Q85 T86 R90 R93 R103 K105 I107 D108 Y16 K19 K20 R68 Q71 T72 R76 R79 R89 K91 I93 D94
BS02 dna A K15 Y16 K84 R88 R91 K92 W114 R122 T127 L128 K1 Y2 K70 R74 R77 K78 W100 R108 T113 L114
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3veb, PDBe:3veb, PDBj:3veb
PDBsum3veb
PubMed23084832
UniProtQ8ZG78|MATP_YERPE Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]