Structure of PDB 3vad Chain A

Receptor sequence
>3vadA (length=310) Species: 10116 (Rattus norvegicus) [Search protein sequence]
VRLTPTMMLYSGRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIG
CNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVT
LLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGFRMLATHHLALHEDKPDF
VGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPM
PLDYILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRG
GGIAHKDLDRVMDYHFTTAHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGT
DVYLRLRHID
3D structure
PDB3vad Crystal structure of I170F mutant branched-chain alpha-ketoacid dehydrogenase kinase in complex with 3,6-dichlorobenzo[b]thiophene-2-carboxylic acid
ChainA
Resolution2.602 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y241 E245 K248 N249
Catalytic site (residue number reindexed from 1) Y204 E208 K211 N212
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
2.7.11.4: [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A N249 R252 A253 I290 V298 T304 T305 G335 G337 G339 L340 N212 R215 A216 I253 V261 T267 T268 G271 G273 G275 L276
BS02 0F1 A L68 Y99 V125 L128 H132 R167 R171 L31 Y62 V88 L91 H95 R130 R134
BS03 0F1 A R71 I72 R75 Y99 H132 S166 R167 F170 R34 I35 R38 Y62 H95 S129 R130 F133
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0004740 pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0047323 [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006550 isoleucine catabolic process
GO:0006552 L-leucine catabolic process
GO:0006574 valine catabolic process
GO:0007283 spermatogenesis
GO:0008610 lipid biosynthetic process
GO:0009083 branched-chain amino acid catabolic process
GO:0010906 regulation of glucose metabolic process
GO:0016310 phosphorylation
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0045252 oxoglutarate dehydrogenase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vad, PDBe:3vad, PDBj:3vad
PDBsum3vad
PubMed
UniProtQ00972|BCKD_RAT Branched-chain alpha-ketoacid dehydrogenase kinase (Gene Name=Bckdk)

[Back to BioLiP]