Structure of PDB 3v9x Chain A

Receptor sequence

>3v9xA (length=211) Species: 83333 (Escherichia coli K-12)

AQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMP
DTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVR
KGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAAL
AGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRL
GGWPLSAAEEV

3D structure

• PDB: 3v9x How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E25 T26 F29 F77 N78 H120 N121 F124 V163	E21 T22 F25 F73 N74 H116 N117 F120 V159
BS02	dna	A	R15 H144 F146	R11 H140 F142
BS03	MG	A	E25 H181 D186	E21 H177 D182

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3v9x, PDBe:3v9x, PDBj:3v9x
• PDBsum: 3v9x
• PubMed: 22718982
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)