Structure of PDB 3v9w Chain A

Receptor sequence
>3v9wA (length=202) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTL
HFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIK
ASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLA
LGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWP
LS
3D structure
PDB3v9w How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
ChainA
Resolution1.702 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.13.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A E25 T26 F29 A74 F77 N78 H120 N121 F124 V163 L164 E17 T18 F21 A66 F69 N70 H112 N113 F116 V155 L156
BS02 dna A H144 F146 H136 F138
BS03 MG A D23 E25 H181 D186 D15 E17 H173 D178
BS04 CO A F65 R135 F57 R127
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006396 RNA processing
GO:0006974 DNA damage response
GO:0008033 tRNA processing
GO:0031125 rRNA 3'-end processing
GO:0034644 cellular response to UV
GO:0042780 tRNA 3'-end processing
GO:0043628 regulatory ncRNA 3'-end processing
GO:0045004 DNA replication proofreading
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3v9w, PDBe:3v9w, PDBj:3v9w
PDBsum3v9w
PubMed22718982
UniProtP30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)

[Back to BioLiP]