Structure of PDB 3v6k Chain A

Receptor sequence

>3v6kA (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 3v6k Replication of n(2) ,3-ethenoguanine by DNA polymerases.
• Chain: A
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G185 I186 G187 I189 T190 S297 G299 T301 K339	G185 I186 G187 I189 T190 S297 G299 T301 K339
BS02	dna	A	V32 R36 F37 S40 G41 A42 G58 P60 G218 A220 R242 K243 S244 G246 R247 T250 K252 K275 R331 R332 R336	V32 R36 F37 S40 G41 A42 G58 P60 G218 A220 R242 K243 S244 G246 R247 T250 K252 K275 R331 R332 R336
BS03	MG	A	D7 D105	D7 D105
BS04	CA	A	A181 I186	A181 I186

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3v6k, PDBe:3v6k, PDBj:3v6k
• PDBsum: 3v6k
• PubMed: 22488769
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)