Structure of PDB 3v4y Chain A

Receptor sequence

>3v4yA (length=293) Species: 9606 (Homo sapiens) [Search protein sequence]

LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELE
APLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICL
LLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCF
NCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLW
SDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
FFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA

3D structure

PDB

3v4y The Molecular Basis for Substrate Specificity of the Nuclear NIPP1:PP1 Holoenzyme.

Chain

Resolution

2.098 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D64 H66 D92 D95 R96 N124 H125 H173 R221 H248
Catalytic site (residue number reindexed from 1)	D58 H60 D86 D89 R90 N118 H119 H167 R215 H242
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D92 N124 H173 H248	D86 N118 H167 H242
BS02	MN	A	D64 H66 D92	D58 H60 D86

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0008157	protein phosphatase 1 binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0017018	myosin phosphatase activity
GO:0043021	ribonucleoprotein complex binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding
GO:0046914	transition metal ion binding
GO:0098641	cadherin binding involved in cell-cell adhesion

	Biological Process
GO:0005977	glycogen metabolic process
GO:0005979	regulation of glycogen biosynthetic process
GO:0005981	regulation of glycogen catabolic process
GO:0006470	protein dephosphorylation
GO:0010288	response to lead ion
GO:0016311	dephosphorylation
GO:0030324	lung development
GO:0032922	circadian regulation of gene expression
GO:0042752	regulation of circadian rhythm
GO:0043153	entrainment of circadian clock by photoperiod
GO:0043247	telomere maintenance in response to DNA damage
GO:0043558	regulation of translational initiation in response to stress
GO:0045725	positive regulation of glycogen biosynthetic process
GO:0048754	branching morphogenesis of an epithelial tube
GO:0051301	cell division
GO:0060828	regulation of canonical Wnt signaling pathway
GO:0098609	cell-cell adhesion
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

	Cellular Component
GO:0000164	protein phosphatase type 1 complex
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0042587	glycogen granule
GO:0043025	neuronal cell body
GO:0043197	dendritic spine
GO:0043204	perikaryon
GO:0070062	extracellular exosome
GO:0072357	PTW/PP1 phosphatase complex
GO:0098793	presynapse
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3v4y, PDBe:3v4y, PDBj:3v4y
PDBsum	3v4y
PubMed	22940584
UniProt	P62136\|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (Gene Name=PPP1CA)

[Back to BioLiP]