Structure of PDB 3v11 Chain A

Receptor sequence

>3v11A (length=404) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence]

QPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNI
GVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLS
GAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSK
EEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPY
RDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVL
PGLRVVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNL
LGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSV
GSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWG
LVEI

3D structure

PDB

3v11 Structure of the ternary initiation complex aIF2-GDPNP-methionylated initiator tRNA.

Chain

Resolution

5.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D19 K22 T23 T46 H97
Catalytic site (residue number reindexed from 1)	D13 K16 T17 T40 H91
Enzyme Commision number	3.6.5.3: protein-synthesizing GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	P65 V151 K156 A159 Y163 R164 K167 I181 P182 V183 I189 N190 D192 S193	P59 V145 K150 A153 Y157 R158 K161 I175 P176 V177 I183 N184 D186 S187
BS02	rna	A	S35 H37 S38 E39 F221 V223 P226 S278 R280 A296	S29 H31 S32 E33 F215 V217 P220 S267 R269 A285	PDBbind-CN: Kd=1nM
BS03	MG	A	T23 K36 T46	T17 K30 T40
BS04	GNP	A	V18 D19 G21 K22 T23 T24 K36 M45 G96 N149 K150 D152 L186	V12 D13 G15 K16 T17 T18 K30 M39 G90 N143 K144 D146 L180
BS05	MET	A	Y51 R219 R280 F281 L294 V295 A296	Y45 R213 R269 F270 L283 V284 A285

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003743	translation initiation factor activity
GO:0003746	translation elongation factor activity
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding

	Biological Process
GO:0001731	formation of translation preinitiation complex
GO:0006412	translation
GO:0006413	translational initiation
GO:0006414	translational elongation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3v11, PDBe:3v11, PDBj:3v11
PDBsum	3v11
PubMed	22447243
UniProt	Q980A5\|IF2G_SACS2 Translation initiation factor 2 subunit gamma (Gene Name=eif2g)

[Back to BioLiP]