Structure of PDB 3uqo Chain A

Receptor sequence

>3uqoA (length=223) Species: 9913 (Bos taurus)

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
ASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGFYTKVCNYVSWIKQTIASN

3D structure

• PDB: 3uqo Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 Q192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H40 D84 Q174 G175 D176 S177 G178
• Enzyme Commision number: 3.4.21.4: trypsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	E70 N72 V75 E80	E52 N54 V57 E62
BS02	3YH	A	E97 T98 Y99 F174 D189 A190 C191 Q192 V213 W215 G216 G219 C220	E79 T80 Y81 F154 D171 A172 C173 Q174 V191 W193 G194 G196 C197	BindingDB: Ki=21nM

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0046872 metal ion binding
• GO:0097655 serpin family protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0007586 digestion

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:3uqo, PDBe:3uqo, PDBj:3uqo
• PDBsum: 3uqo
• PubMed: 25003390
• UniProt: P00760|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)