Structure of PDB 3uq6 Chain A

Receptor sequence
>3uq6A (length=345) Species: 6183 (Schistosoma mansoni) [Search protein sequence]
DLSEGYVFGMGNPLLDIIVDADDFMYRKYNLKKDNIVLAEEKHMTIYDEI
QKKKKLNYIAGGATLNTVKMIQWIIQKPFVCSYVGCIGADIQGKYIKNDC
SALDLVTEFQIAEEPLMTGKVAVLVSEKLRSMVTYLGAACDLSLAHIEQP
HVWSLVEKAQVYYIAGFVINTCYEGMLKIAKHSLENEKLFCFNLSAPFLS
QFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIADLPF
ADGKKRKRLVIITRGKNPLLYTDSSDSEIHQFMVEQFKDDQIIDTNGAGD
AFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGFSLGSRDSYS
3D structure
PDB3uq6 Adenosine kinase from Schistosoma mansoni: structural basis for the differential incorporation of nucleoside analogues.
ChainA
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADN A N14 L16 D18 I38 G64 V123 T136 F169 N298 D302 N12 L14 D16 I36 G62 V121 T134 F167 N296 D300
BS02 AMP A T265 G267 K268 V286 F289 A329 I333 T263 G265 K266 V284 F287 A327 I331
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Dec 18 19:15:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3uq6', asym_id = 'A', title = 'Adenosine kinase from Schistosoma mansoni: struc...fferential incorporation of nucleoside analogues.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3uq6', asym_id='A', title='Adenosine kinase from Schistosoma mansoni: struc...fferential incorporation of nucleoside analogues.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004001,0006166,0016301', uniprot = '', pdbid = '3uq6', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004001,0006166,0016301', uniprot='', pdbid='3uq6', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>