Structure of PDB 3und Chain A

Receptor sequence

>3undA (length=283) Species: 320372 (Burkholderia pseudomallei 1710b)

GSMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGI
PFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAE
QAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKH
VVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDV
THSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCD
GPSALPLHQLEGLLSQMKAIDDLVKRMPALEIR

3D structure

• PDB: 3und Combining functional and structural genomics to sample the essential Burkholderia structome.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A5P	A	K58 N60 R61 S62 H200 Q203 R205 A211 S212 D248	K60 N62 R63 S64 H202 Q205 R207 A213 S214 D250
BS02	PEP	A	K53 Q111 P113 A114 K136 R166 H200	K55 Q113 P115 A116 K138 R168 H202
BS03	KD0	A	K53 K58 N60 R61 S62 Q111 K136 H200 R205 A211 S212 D248	K55 K60 N62 R63 S64 Q113 K138 H202 R207 A213 S214 D250

Gene Ontology

Molecular Function

• GO:0008676 3-deoxy-8-phosphooctulonate synthase activity
• GO:0016740 transferase activity

Biological Process

• GO:0009058 biosynthetic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0019294 keto-3-deoxy-D-manno-octulosonic acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3und, PDBe:3und, PDBj:3und
• PDBsum: 3und
• PubMed: 23382856
• UniProt: Q3JP68