Structure of PDB 3ums Chain A

Receptor sequence
>3umsA (length=337) Species: 9606 (Homo sapiens) [Search protein sequence]
SAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKI
IHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDAR
QLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYY
LNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVAFEG
VTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILF
LNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTK
EIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
3D structure
PDB3ums Regulators of G-protein signaling accelerate GPCR signaling kinetics and govern sensitivity solely by accelerating GTPase activity.
ChainA
Resolution2.343 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E43 T48 R178 D200
Catalytic site (residue number reindexed from 1) E38 T43 R173 D195
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A E43 S44 G45 K46 S47 T48 L175 R176 T177 N269 K270 D272 L273 C325 A326 E38 S39 G40 K41 S42 T43 L170 R171 T172 N252 K253 D255 L256 C308 A309
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0010854 adenylate cyclase regulator activity
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0031749 D2 dopamine receptor binding
GO:0031821 G protein-coupled serotonin receptor binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007198 adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0034695 response to prostaglandin E
GO:0043434 response to peptide hormone
GO:0043949 regulation of cAMP-mediated signaling
GO:0045542 positive regulation of cholesterol biosynthetic process
GO:0051301 cell division
GO:0060236 regulation of mitotic spindle organization
GO:0072678 T cell migration
GO:1904322 cellular response to forskolin
GO:1904778 positive regulation of protein localization to cell cortex
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ums, PDBe:3ums, PDBj:3ums
PDBsum3ums
PubMed
UniProtP63096|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=GNAI1)

[Back to BioLiP]