Structure of PDB 3ufj Chain A

Receptor sequence

>3ufjA (length=185) Species: 9606 (Homo sapiens) [Search protein sequence]

LTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLS
EVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKL
QKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVM
PSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIER

3D structure

PDB

3ufj Lesion processing by a repair enzyme is severely curtailed by residues needed to prevent aberrant activity on undamaged DNA.

Chain

Resolution

2.967 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	N140 H151
Catalytic site (residue number reindexed from 1)	N21 H32
Enzyme Commision number	3.2.2.29: thymine-DNA glycosylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	N140 G142 A145 H151 Y152 N157 N191 S200 G231 K232 C233 S271 S273 A274 R275	N21 G23 A26 H32 Y33 N38 N72 S81 G112 K113 C114 S152 S154 A155 R156
BS02	dna	A	S200 K201 G231 P270 R275 C276 A277 Q278	S81 K82 G112 P151 R156 C157 A158 Q159
BS03	dna	A	P155 G156 R275 A277 P280	P36 G37 R156 A158 P161

Gene Ontology

	Molecular Function
GO:0000700	mismatch base pair DNA N-glycosylase activity

	Biological Process
GO:0006285	base-excision repair, AP site formation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ufj, PDBe:3ufj, PDBj:3ufj
PDBsum	3ufj
PubMed	22573813
UniProt	Q13569\|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]