Structure of PDB 3uct Chain A

Receptor sequence
>3uctA (length=76) Species: 9606 (Homo sapiens) [Search protein sequence]
DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDM
INEVDADGNGTIDFPEFLTMMARKMK
3D structure
PDB3uct X-ray Structures of Magnesium and Manganese Complexes with the N-Terminal Domain of Calmodulin: Insights into the Mechanism and Specificity of Metal Ion Binding to an EF-Hand.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D20 D22 D24 T26 D19 D21 D23 T25
BS02 MN A D56 D58 N60 T62 D55 D57 N59 T61
BS03 MN A D22 D24 D21 D23
BS04 MN A F19 E31 F18 E30
BS05 ZN A D64 E67 D63 E66
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:3uct, PDBe:3uct, PDBj:3uct
PDBsum3uct
PubMed22803592
UniProtP0DP23|CALM1_HUMAN Calmodulin-1 (Gene Name=CALM1)

[Back to BioLiP]