Structure of PDB 3u88 Chain A

Receptor sequence
>3u88A (length=477) Species: 9606 (Homo sapiens) [Search protein sequence]
GLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVN
RVIPTNVPELTFQPSPAPDGGLTYFPVADLSIIAALYARFTAQIRGAVDL
SLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLD
SSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGN
EDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDS
LELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYH
KGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNY
CREDEEIYKEFFEVANDVIPNLLKEAASLLEASALQDPECFAHLLRFYDG
ICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSEGPVLTFQSE
KMKGMKELLVATKINSSAIKLQLTAQS
3D structure
PDB3u88 The same pocket in menin binds both MLL and JUND but has opposite effects on transcription.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GGB A Y133 F134 R137 K151 Y130 F131 R134 K148
BS02 0BR A W126 L129 S130 R131 W198 W123 L126 S127 R128 W195
BS03 GGB A G111 V112 S113 G108 V109 S110
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0000403 Y-form DNA binding
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0051219 phosphoprotein binding
GO:0070412 R-SMAD binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000165 MAPK cascade
GO:0001933 negative regulation of protein phosphorylation
GO:0002076 osteoblast development
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0008285 negative regulation of cell population proliferation
GO:0009411 response to UV
GO:0010332 response to gamma radiation
GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045064 T-helper 2 cell differentiation
GO:0045668 negative regulation of osteoblast differentiation
GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045786 negative regulation of cell cycle
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046329 negative regulation of JNK cascade
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005788 endoplasmic reticulum lumen
GO:0005829 cytosol
GO:0016363 nuclear matrix
GO:0017053 transcription repressor complex
GO:0032154 cleavage furrow
GO:0032991 protein-containing complex
GO:0035097 histone methyltransferase complex
GO:0044665 MLL1/2 complex
GO:0071339 MLL1 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3u88, PDBe:3u88, PDBj:3u88
PDBsum3u88
PubMed22327296
UniProtO00255|MEN1_HUMAN Menin (Gene Name=MEN1)

[Back to BioLiP]