Structure of PDB 3u31 Chain A

Receptor sequence
>3u31A (length=263) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
KKDTQSITLEELAKIIKKCKHVVALTGSGTSAESNIPSFRGSSNSIWSKY
DPRIYGTIWGFWKYPEKIWEVIRDISSDYEIEINNGHVALSTLESLGYLK
SVVTQNVDGLHEASGNTKVISLHGNVFEAVCCTCNKIVKLNKIMLQKTSH
FMHQLPPECPCGGIFKPNIILFGEVVSSDLLKEAEEEIAKCDLLLVIGTS
STVSTATNLCHFACKKKKKIVEINISKTYITNKMSDYHVCAKFSELTKVA
NILKGSSEKNKKI
3D structure
PDB3u31 Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) P46 S47 F48 R49 N115 D117 H132
Catalytic site (residue number reindexed from 1) P37 S38 F39 R40 N106 D108 H123
Enzyme Commision number 2.3.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A H132 I179 L180 F181 G182 E183 V185 V212 S213 H123 I170 L171 F172 G173 E174 V176 V203 S204
BS02 NAD A G36 S37 G38 E42 R49 G207 T208 S209 V212 N233 I234 K251 F252 G27 S28 G29 E33 R40 G198 T199 S200 V203 N224 I225 K242 F243
BS03 ZN A C140 C143 C168 C170 C131 C134 C159 C161
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0036054 protein-malonyllysine demalonylase activity
GO:0036055 protein-succinyllysine desuccinylase activity
GO:0046872 metal ion binding
GO:0070403 NAD+ binding
Biological Process
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006476 protein deacetylation
GO:0016233 telomere capping
GO:0036049 peptidyl-lysine desuccinylation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005677 chromatin silencing complex
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3u31, PDBe:3u31, PDBj:3u31
PDBsum3u31
PubMed21992006
UniProtQ8IE47|SIR2A_PLAF7 NAD-dependent protein deacylase Sir2A (Gene Name=Sir2A)

[Back to BioLiP]