Structure of PDB 3u2w Chain A

Receptor sequence

>3u2wA (length=262) Species: 9606 (Homo sapiens)

MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKV
LETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVF
MDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLL
HLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIFSYLPA
FKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWW
NIFTTNVLPLLQ

3D structure

• PDB: 3u2w Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
• Chain: A
• Resolution: 1.68 Å

Enzymatic activity

• Enzyme Commision number: 2.4.1.186: glycogenin glucosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D102 D104 H212	D102 D104 H212
BS02	UDP	A	L9 T10 T11 Y15 R77 L80 T83 D102 A103 D104 H212 G215 K218	L9 T10 T11 Y15 R77 L80 T83 D102 A103 D104 H212 G215 K218
BS03	GLC	A	K86 D102 N133 S134 G135 D160 G162 D163 Q164	K86 D102 N133 S134 G135 D160 G162 D163 Q164
BS04	LCN	A	M75 L80 D160 G162 D163 Q164	M75 L80 D160 G162 D163 Q164

Gene Ontology

Molecular Function

• GO:0016757 glycosyltransferase activity

External links

• PDB: RCSB:3u2w, PDBe:3u2w, PDBj:3u2w
• PDBsum: 3u2w
• PubMed: 22160680
• UniProt: P46976|GLYG_HUMAN Glycogenin-1 (Gene Name=GYG1)