Structure of PDB 3tzl Chain A

Receptor sequence

>3tzlA (length=319) Species: 192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)

MRVLTGLQPSGDLHIGNYFGAIKQMVDAQEKSQMFMFIANYHAMTSSQDG
EKLKQNSLKAAAAFLSLGIDPQKSVFWLQSDVKEVMELYWILSQFTPMGL
LERAHSYKDKVAKGLSASHGLFSYPVLMAADILLFDTRIVPVGKDQIQHV
EIARDIALKVNNEWGEIFTLPEARVNEEVAVVVGTDGAKMSKSYQNTIDI
FSSEKTLKKQISSIVTDSTALEDPKDHENCNIFKIAKLFLDESGQKELQI
RYEKGGEGYGHFKIYLNELVNAYFKEAREKYNELLEKPSHLKEILDFGAT
KARKIAQEKMQKIYEKIGL

3D structure

• PDB: 3tzl Crystal Structure of Tryptophanyl-tRNA Synthetase from Campylobacter jejuni complexed with ADP and Tryptophane
• Chain: A
• Resolution: 2.154 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K110 K189 K192
• Catalytic site (residue number reindexed from 1): K110 K189 K192
• Enzyme Commision number: 6.1.1.2: tryptophan--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	H14 G16 N17 V182 M190 S191 K192	H14 G16 N17 V182 M190 S191 K192
BS02	TRP	A	G6 Q8 F37 H42 Y124 M128 D131 V140 Q146	G6 Q8 F37 H42 Y124 M128 D131 V140 Q146

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0004830 tryptophan-tRNA ligase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006412 translation
• GO:0006418 tRNA aminoacylation for protein translation
• GO:0006436 tryptophanyl-tRNA aminoacylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3tzl, PDBe:3tzl, PDBj:3tzl
• PDBsum: 3tzl
• UniProt: Q9PIB4|SYW_CAMJE Tryptophan--tRNA ligase (Gene Name=trpS)