Structure of PDB 3ty3 Chain A

Receptor sequence

>3ty3A (length=358) Species: 284812 (Schizosaccharomyces pombe 972h-)

RRIVLGLIPADGIGKEVVPAARRLMENLPAKHKLKFDFIDLDAGWGTFER
TGKALPERTVERLKTECNAALFGAVQSPTHKVAGYSSPIVALRKKMGLYA
NVRPVKSLDGAKGKPVDLVIVRENTECLYVKEERMVQNTPGKRVAEAIRR
ISEEASTKIGKMAFEIAKSRQKIRESGTYSIHKKPLVTIIHKSNVMSVTD
GLFRESCRHAQSLDPSYASINVDEQIVDSMVYRLFREPECFDVVVAPNLY
GDILSDGAASLIGSLGLVPSANVGDNFVMSEPVHGSAPDIAGRGIANPVA
TFRSVALMLEFMGHQDAAADIYTAVDKVLTEGKVLTPDLGGKSGTNEITD
AVLANIHN

3D structure

• PDB: 3ty3 Crystal structure of homoisocitrate dehydrogenase from Schizosaccharomyces pombe.
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y133 K196 D232 D256 D260
• Catalytic site (residue number reindexed from 1): Y129 K192 D228 D252 D256
• Enzyme Commision number: 1.1.1.87: homoisocitrate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GGG	A	A78 V79 S81 R97 E285 P286 H288	A74 V75 S77 R93 E281 P282 H284

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004449 isocitrate dehydrogenase (NAD+) activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding
• GO:0047046 homoisocitrate dehydrogenase activity
• GO:0051287 NAD binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006102 isocitrate metabolic process
• GO:0009085 lysine biosynthetic process
• GO:0019878 lysine biosynthetic process via aminoadipic acid

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:3ty3, PDBe:3ty3, PDBj:3ty3
• PDBsum: 3ty3
• PubMed: 22105743
• UniProt: O14104|LYS12_SCHPO Homoisocitrate dehydrogenase (Gene Name=lys12)