Structure of PDB 3tsl Chain A

Receptor sequence

>3tslA (length=113) Species: 11855 (Mason-Pfizer monkey virus)

QKQPISKLTRATPGSAGLDLCSTSHTVLTPEMGPQALSTGIYGPLPPNTF
GLILGRSSITMKGLQVYPGVIDNDYTGEIKIMAKAVNNIVTVSQGNRIAQ
LILLPLIETDNKV

3D structure

• PDB: 3tsl Crystallization and Preliminary X-Ray Studies of Dutpase from Mason-Pfizer Monkey Retrovirus.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A39 R79 S81 K85 D95
• Catalytic site (residue number reindexed from 1): A16 R56 S58 K62 D72
• Enzyme Commision number: 3.4.23.-
  3.6.1.23: dUTP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UMP	A	I76 G92 V93 I94 D95 Y98 K103	I53 G69 V70 I71 D72 Y75 K80

External links

• PDB: RCSB:3tsl, PDBe:3tsl, PDBj:3tsl
• PDBsum: 3tsl
• UniProt: P07570|PRO_MPMV Gag-Pro polyprotein (Gene Name=gag-pro)