Structure of PDB 3ts0 Chain A

Receptor sequence

>3ts0A (length=136) Species: 10090 (Mus musculus)

PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGF
RSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCG
GLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ

3D structure

• PDB: 3ts0 Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
• Chain: A
• Resolution: 2.763 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K45 W46 F47 N48 V49 R50 M51 F53 F55 D71 F73 H75 Q76 F84 R85 E89 S100 K102 E105	K11 W12 F13 N14 V15 R16 M17 F19 F21 D37 F39 H41 Q42 F50 R51 E55 S66 K68 E71
BS02	rna	A	G136 R138 C139 Y140 H148 A149 Q157 K159 K160 C161 H162 F163 M170 V171 K177	G93 R95 C96 Y97 H105 A106 Q114 K116 K117 C118 H119 F120 M127 V128 K134
BS03	ZN	A	C139 C142 H147 C152	C96 C99 H104 C109
BS04	ZN	A	C161 C164 H169 C174	C118 C121 H126 C131

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:3ts0, PDBe:3ts0, PDBj:3ts0
• PDBsum: 3ts0
• PubMed: 22078496
• UniProt: Q8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)