Structure of PDB 3tlx Chain A

Receptor sequence
>3tlxA (length=235) Species: 5833 (Plasmodium falciparum) [Search protein sequence]
FSTIDLLNELKRRYACLSKPDGRYIFLGAPGSGKGTQSLNLKKSHCYCHL
STGDLLREAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKTPQCKK
GFILDGYPRNVKQAEDLNKLLQKNQTKLDGVFYFNVPDEVLVNRISGRLI
HKPSGRIYHKIFNPPKVPFRDDVTNEPLIQREDDNEDVLKKRLTVFKSET
SPLISYYKNKNLLINLDATQPANDLEKKISQHIDG
3D structure
PDB3tlx Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
ChainA
Resolution2.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K41 R116 R155 R188 R199
Catalytic site (residue number reindexed from 1) K34 R109 R148 R181 R192
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A Q187 R188 E189 N192 Q180 R181 E182 N185
BS02 MG A H239 G242 H232 G235
BS03 AMP A T59 G60 L63 K85 L86 V87 V92 G113 Q120 R199 T52 G53 L56 K78 L79 V80 V85 G106 Q113 R192
BS04 ADP A G38 G40 K41 G42 T43 R151 R155 I164 Y165 H166 F169 A229 G31 G33 K34 G35 T36 R144 R148 I157 Y158 H159 F162 A222
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0006139 nucleobase-containing compound metabolic process
GO:0016310 phosphorylation
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3tlx, PDBe:3tlx, PDBj:3tlx
PDBsum3tlx
PubMed
UniProtQ8IJV6|KAD1_PLAF7 Adenylate kinase 1 (Gene Name=AK1)

[Back to BioLiP]