Structure of PDB 3tjz Chain A

Receptor sequence
>3tjzA (length=159) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWD
VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELR
NAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLY
EGLEWLSNS
3D structure
PDB3tjz A structure-based mechanism for arf1-dependent recruitment of coatomer to membranes.
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q71
Catalytic site (residue number reindexed from 1) Q54
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP A G27 G29 K30 T31 T32 T45 T48 G69 G70 N126 K127 D129 C159 T161 G10 G12 K13 T14 T15 T28 T31 G52 G53 N109 K110 D112 C142 T144
BS02 MG A T31 T48 D67 T14 T31 D50
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006893 Golgi to plasma membrane transport
GO:0010636 positive regulation of mitochondrial fusion
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0016236 macroautophagy
GO:0019217 regulation of fatty acid metabolic process
GO:0048193 Golgi vesicle transport
GO:0090141 positive regulation of mitochondrial fission
GO:1903292 protein localization to Golgi membrane
GO:1903358 regulation of Golgi organization
Cellular Component
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0044232 organelle membrane contact site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3tjz, PDBe:3tjz, PDBj:3tjz
PDBsum3tjz
PubMed22304919
UniProtP11076|ARF1_YEAST ADP-ribosylation factor 1 (Gene Name=ARF1)

[Back to BioLiP]