Structure of PDB 3ti0 Chain A

Receptor sequence

>3ti0A (length=579) Species: 129337 (Geobacillus)

KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLR
PETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLA
AYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHL
VRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDT
KRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVL
KKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRP
ATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDW
LIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVK
RYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQ
GSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRL
VPEVMEQAVTLRVPLKVDYHYGSTWYDAK

3D structure

• PDB: 3ti0 Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
• Chain: A
• Resolution: 1.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P531 T550 K551 T552 T556 R578 Q579 Y587 R615 Q624 N625 I626 P627 I628 R629 V828 H829	P234 T253 K254 T255 T259 R281 Q282 Y290 R318 Q327 N328 I329 P330 I331 R332 V531 H532
BS02	dna	A	N527 N529 S530 Q533 K582 S585 T586 L610 T611 Q612 T613 S617 S618 T619 E620 N622 G711 Y714 I716 S717 Y719 G720 R729 R771 F781 F786 R789 N793 Q797	N230 N232 S233 Q236 K285 S288 T289 L313 T314 Q315 T316 S320 S321 T322 E323 N325 G414 Y417 I419 S420 Y422 G423 R432 R474 F484 F489 R492 N496 Q500
BS03	DG3	A	R615 D653 Y654 S655 Q656 I657 E658 H682 R702 K706 Y710 Y714 D830	R318 D356 Y357 S358 Q359 I360 E361 H385 R405 K409 Y413 Y417 D533
BS04	MG	A	D653 Y654 D830	D356 Y357 D533

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 22:30:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3ti0', asym_id = 'A', title = 'Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3ti0', asym_id='A', title='Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003677,0003887,0006139,0006260,0006261,0008408', uniprot = '', pdbid = '3ti0', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003887,0006139,0006260,0006261,0008408', uniprot='', pdbid='3ti0', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>