Structure of PDB 3tct Chain A

Receptor sequence

>3tctA (length=115) Species: 9606 (Homo sapiens)

PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT
EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL
LSPYSYSTTAVVTNP

3D structure

• PDB: 3tct Tafamidis, a potent and selective transthyretin kinetic stabilizer that inhibits the amyloid cascade.
• Chain: A
• Resolution: 1.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3MI	A	L110 S117 T118	L100 S107 T108	MOAD: Kd=3nM PDBbind-CN: -logKd/Ki=8.52,Kd=3nM BindingDB: IC50=3100nM,Kd=274nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3tct, PDBe:3tct, PDBj:3tct
• PDBsum: 3tct
• PubMed: 22645360
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)