Structure of PDB 3tbn Chain A

Receptor sequence

>3tbnA (length=87) Species: 342108 (Paramagnetospirillum magneticum AMB-1) [Search protein sequence]

GSSHHHHHHTDPVIAQKAPYPVTVEAGKTYHWCACGRSKAQPFCDGSHKG
TGLAPVAYTPDKAGTAYFCGCKASKAPPLCDGTHKTL

3D structure

PDB

3tbn Structure and Molecular Evolution of CDGSH Iron-Sulfur Domains.

Chain

Resolution

1.15 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	A	C25 A26 C27 C36 D37 G38 S39 H40 P47	C33 A34 C35 C44 D45 G46 S47 H48 P55
BS02	FES	A	A10 P11 C61 G62 C63 S66 C72 D73 G74 T75 H76	A18 P19 C69 G70 C71 S74 C80 D81 G82 T83 H84

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding
GO:0051537	2 iron, 2 sulfur cluster binding

	Biological Process
GO:0106034	protein maturation by [2Fe-2S] cluster transfer

	Cellular Component
GO:0005737	cytoplasm
GO:0043231	intracellular membrane-bounded organelle

External links