Structure of PDB 3tap Chain A

Receptor sequence

>3tapA (length=580) Species: 129337 (Geobacillus)

AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFL
RPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLL
AAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEH
LVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVD
TKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPV
LKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVR
PDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESD
WLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGV
KRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPI
QGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCR
LVPEVMEQAVTLRVPLKVDYHYGSTWYDAK

3D structure

• PDB: 3tap Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
• Chain: A
• Resolution: 1.655 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	A433 T552 S555 T556 S557 A558 R578 K582 R615 Q624 N625 I626 P627 I628 R629 V828 H829 D830	A137 T256 S259 T260 S261 A262 R282 K286 R319 Q328 N329 I330 P331 I332 R333 V532 H533 D534
BS02	dna	A	N527 N529 S530 T586 L610 T611 Q612 T613 R615 S617 S618 T619 N622 G711 Y714 S717 G720 N724 R771 F786 R789 Q797	N231 N233 S234 T290 L314 T315 Q316 T317 R319 S321 S322 T323 N326 G415 Y418 S421 G424 N428 R475 F490 R493 Q501
BS03	GLC	A	E325 I605	E29 I309
BS04	FRU	A	D372 R375 D408 N607	D76 R79 D112 N311
BS05	GLC	A	Q755 K758 E788	Q459 K462 E492

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 08:03:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3tap', asym_id = 'A', title = 'Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3tap', asym_id='A', title='Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003677,0003887,0006139,0006260,0006261,0008408', uniprot = '', pdbid = '3tap', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003887,0006139,0006260,0006261,0008408', uniprot='', pdbid='3tap', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>