Structure of PDB 3t9c Chain A

Receptor sequence

>3t9cA (length=325) Species: 9606 (Homo sapiens)

RQIVVGICSMAKKSKSKPMKEILERISLFKYITVVVFEEEVILNEPVENW
PLCDCLISFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRREVYSIL
QAEGILLPRYAILNRDPNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSA
EDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSYIYEEFMP
TDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREK
LIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKI
LGNIVMRELAPQFHIPWSIPLEAED

3D structure

• PDB: 3t9c Structural basis for an inositol pyrophosphate kinase surmounting phosphate crowding.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.24: diphosphoinositol-pentakisphosphate 1-kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ANP	A	R134 V185 K187 H194 L211 R213 E237 F239 M240 D246 S264 D309 L311 C320 D321 N323	R93 V144 K146 H153 L170 R172 E196 F198 M199 D205 S223 D268 L270 C279 D280 N282
BS02	IHP	A	K53 K54 R213 K214 R262 S326 K329	K12 K13 R172 K173 R221 S285 K288
BS03	MG	A	D321 N323	D280 N282
BS04	MG	A	D309 D321	D268 D280
BS05	MG	A	S68 F70 I73	S27 F29 I32

Gene Ontology

Molecular Function

• GO:0000829 diphosphoinositol pentakisphosphate kinase activity

External links

• PDB: RCSB:3t9c, PDBe:3t9c, PDBj:3t9c
• PDBsum: 3t9c
• PubMed: 22119861
• UniProt: O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 (Gene Name=PPIP5K2)