Structure of PDB 3t2z Chain A

Receptor sequence

>3t2zA (length=427) Species: 243159 (Acidithiobacillus ferrooxidans ATCC 23270)

SAHVVILGAGTGGMPAAYEMKEALGSGHEVTLISANDYFQFVPSNPWVGV
GWKERDDIAFPIRHYVERKGIHFIAQSAEQIDAEAQNITLADGNTVHYDY
LMIATGPKLAFENVPGSDPHEGPVQSICTVDHAERAFAEYQALLREPGPI
VIGAMAGASCFGPAYEYAMIVASDLKKRGMRDKIPSFTFITSEPYIGHLG
IQGVGDSKGILTKGLKEEGIEAYTNCKVTKVEDNKMYVTQVDEKGETIKE
MVLPVKFGMMIPAFKGVPAVAGVEGLCNPGGFVLVDEHQRSKKYANIFAA
GIAIAIPPVETTPVPTGAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMG
TWNAVCFADMGDRGAAFIALPQLKPRKVDVFAYGRWVHLAKVAFEKYFIR
KMKMGVSEPFYEKVLFKMMGITRLKEE

3D structure

• PDB: 3t2z Crystal structure of sulfide:quinone oxidoreductase from Acidithiobacillus ferrooxidans: insights into sulfidotrophic respiration and detoxification.
• Chain: A
• Resolution: 2.2994 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C128 C160 H198 C356 D359 K391
• Catalytic site (residue number reindexed from 1): C128 C160 H198 C356 D359 K391
• Enzyme Commision number: 1.8.5.4: bacterial sulfide:quinone reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G8 G10 T11 G12 S34 A35 V42 P43 S77 A78 A104 T105 G106 C128 C160 P163 G301 I302 T321 G322 I325 V355 F357	G8 G10 T11 G12 S34 A35 V42 P43 S77 A78 A104 T105 G106 C128 C160 P163 G301 I302 T321 G322 I325 V355 F357
BS02	BU2	A	P43 F357 K391 F394 M418	P43 F357 K391 F394 M418
BS03	S3H	A	C160 C356	C160 C356

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0048038 quinone binding
• GO:0070224 sulfide:quinone oxidoreductase activity

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3t2z, PDBe:3t2z, PDBj:3t2z
• PDBsum: 3t2z
• PubMed: 20303979
• UniProt: B7JBP8|SQRD_ACIF2 Sulfide-quinone reductase (Gene Name=AFE_1792)