Structure of PDB 3syu Chain A

Receptor sequence

>3syuA (length=103) Species: 510516 (Aspergillus oryzae RIB40)

CDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFS
VSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFV
ECT

3D structure

• PDB: 3syu Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y38 H40 E58 D76 R77 T91 H92 F100
• Catalytic site (residue number reindexed from 1): Y37 H39 E57 D75 R76 T90 H91 F99
• Enzyme Commision number: 4.6.1.24: ribonuclease T1.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2GP	A	H40 Y42 N43 N44 Y45 E46 X58 F100	H39 Y41 N42 N43 Y44 E45 X57 F99	MOAD: Kd=50uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0016829 lyase activity
• GO:0046589 ribonuclease T1 activity

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0001411 hyphal tip
• GO:0030428 cell septum

External links

• PDB: RCSB:3syu, PDBe:3syu, PDBj:3syu
• PDBsum: 3syu
• PubMed: 22505257
• UniProt: P00651|RNT1_ASPOR Guanyl-specific ribonuclease T1 (Gene Name=rntA)