Structure of PDB 3svw Chain A

Receptor sequence

>3svwA (length=337) Species: 318586 (Paracoccus denitrificans PD1222)

ADDALAALGAQLFVDPALSRNATQSCATCHDPARAFTDPRGDRNTPTLGY
AALVPAFHRDANGKYKGGQFWDGRADDLKQQAGQVMLNPVEMAMPDRAAV
AARLRDDPAYRTGFEALFGKGVLDDPERAFDAAAEALAAYQATGEFSPFD
SKYDRVMRGEEKFTPLEEFGYTVFITWNCRLCHMQRKQGVAERETFTNFE
YHNIGLPVNETAREASGLGADHVDHGLLARPGIEDPAQSGRFKVPSLRNV
AVTGPYMHNGVFTDLRTAILFYNKYTSRRPEAKINPETGAPWGEPEVARN
LSLAELQSGLMLDDGRVDALVAFLETLTDRRYEPLLE

3D structure

• PDB: 3svw Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
• Chain: A
• Resolution: 1.86 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E113
• Catalytic site (residue number reindexed from 1): E91
• Enzyme Commision number: 1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N66 T275 P277	N44 T253 P255
BS02	HEC	A	Q29 C31 C34 H35 R65 T67 P68 L70 Q91 F92 W93 R96 Q103 V107 E113 Q163 K265	Q24 C26 C29 H30 R43 T45 P46 L48 Q69 F70 W71 R74 Q81 V85 E91 Q141 K243
BS03	HEC	A	W93 N200 C201 C204 H205 H224 L228 F264 V266 P267 L269 Y278 M279 H280 Y294	W71 N178 C179 C182 H183 H202 L206 F242 V244 P245 L247 Y256 M257 H258 Y272

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3svw, PDBe:3svw, PDBj:3svw
• PDBsum: 3svw
• PubMed: 22299652
• UniProt: Q51658|MAUG_PARDP Methylamine utilization protein MauG (Gene Name=mauG)